SCOPe 2.06: Domain d5ezha2: 5ezh A:95-214

Lineage for d5ezha2 (5ezh A:95-214)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.121: Tetracyclin repressor-like, C-terminal domain [48497] (1 superfamily)
   multihelical; interlocked (homo)dimer

4. Superfamily a.121.1: Tetracyclin repressor-like, C-terminal domain [48498] (2 families)

5. Family a.121.1.1: Tetracyclin repressor-like, C-terminal domain [48499] (35 proteins)

6. Protein automated matches [226970] (7 species)
   not a true protein

7. Species Mycobacterium tuberculosis [TaxId:83331] [313824] (9 PDB entries)

8. Domain d5ezha2: 5ezh A:95-214 [313838]
   Other proteins in same PDB: d5ezha1
   automated match to d3q0wa2
   complexed with 841, so4

Details for d5ezha2

PDB Entry: 5ezh, 1.7 Å

PDB Description: structure of transcriptional regulatory repressor protein - ethr from mycobacterium tuberculosis in complex with compound 21 at 1.7a resolution

PDB Compounds: (A:) HTH-type transcriptional regulator EthR

SCOPe Domain Sequences for d5ezha2:

Sequence; same for both SEQRES and ATOM records:

>d5ezha2 a.121.1.1 (A:95-214) automated matches {Mycobacterium tuberculosis [TaxId: 83331]}
adtdrenmwrtginvffetfgshkavtragqaaratsvevaelwstfmqkwiaytaavid
aerdrgaaprtlpahelatalnlmnertlfasfageqpsvpearvldtlvhiwvtsiyge

Timeline for d5ezha2:

• d5ezha2 is new in SCOPe 2.06-stable
  
• d5ezha2 appears in SCOPe 2.07
  
• d5ezha2 appears in the current release, SCOPe 2.08