Lineage for d5edta_ (5edt A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2330957Fold a.104: Cytochrome P450 [48263] (1 superfamily)
    multihelical
  4. 2330958Superfamily a.104.1: Cytochrome P450 [48264] (2 families) (S)
  5. 2330959Family a.104.1.1: Cytochrome P450 [48265] (23 protein domains)
  6. 2330984Protein Cyp121 monooxygenase (P450 Mt2) [81865] (3 species)
  7. 2330985Species Mycobacterium bovis [TaxId:233413] [313826] (1 PDB entry)
  8. 2330986Domain d5edta_: 5edt A: [313827]
    automated match to d3cxva_
    complexed with 5mk, hem, so4

Details for d5edta_

PDB Entry: 5edt (more details), 2.45 Å

PDB Description: crystal structure of mycobacterium tuberculosis cyp121 in complex with lig9
PDB Compounds: (A:) Cytochrome P450 121

SCOPe Domain Sequences for d5edta_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5edta_ a.104.1.1 (A:) Cyp121 monooxygenase (P450 Mt2) {Mycobacterium bovis [TaxId: 233413]}
tatvllevpfsargdripdavaelrtrepirkvrtitgaeawlvssyalctqvledrrfs
mketaaagaprlnaltvppevvnnmgniadaglrkavmkaitpkapgleqflrdtansll
dnlitegapadlrndfadplatalhckvlgipqedgpklfrslsiafmssadpipaakin
wdrdieymagilenpnittglmgelsrlrkdpayshvsdelfatigvtffgagvistgsf
lttalisliqrpqlrnllhekpelipagveellrinlsfadglprlatadiqvgdvlvrk
gelvlvlleganfdpehfpnpgsieldrpnptshlafgrgqhfcpgsalgrrhaqigiea
llkkmpgvdlavpidqlvwrtrfqrriperlpvlw

SCOPe Domain Coordinates for d5edta_:

Click to download the PDB-style file with coordinates for d5edta_.
(The format of our PDB-style files is described here.)

Timeline for d5edta_: