Lineage for d5f0fa2 (5f0f A:95-214)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2011555Fold a.121: Tetracyclin repressor-like, C-terminal domain [48497] (1 superfamily)
    multihelical; interlocked (homo)dimer
  4. 2011556Superfamily a.121.1: Tetracyclin repressor-like, C-terminal domain [48498] (2 families) (S)
  5. 2011557Family a.121.1.1: Tetracyclin repressor-like, C-terminal domain [48499] (35 proteins)
  6. 2011877Protein automated matches [226970] (7 species)
    not a true protein
  7. 2011916Species Mycobacterium tuberculosis [TaxId:83331] [313824] (9 PDB entries)
  8. 2011920Domain d5f0fa2: 5f0f A:95-214 [313825]
    Other proteins in same PDB: d5f0fa1
    automated match to d3q0wa2
    complexed with 5td, so4

Details for d5f0fa2

PDB Entry: 5f0f (more details), 1.76 Å

PDB Description: structure of transcriptional regulatory repressor protein - ethr from mycobacterium tuberculosis in complex with compound 15 at 1.76a resolution
PDB Compounds: (A:) HTH-type transcriptional regulator EthR

SCOPe Domain Sequences for d5f0fa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5f0fa2 a.121.1.1 (A:95-214) automated matches {Mycobacterium tuberculosis [TaxId: 83331]}
adtdrenmwrtginvffetfgshkavtragqaaratsvevaelwstfmqkwiaytaavid
aerdrgaaprtlpahelatalnlmnertlfasfageqpsvpearvldtlvhiwvtsiyge

SCOPe Domain Coordinates for d5f0fa2:

Click to download the PDB-style file with coordinates for d5f0fa2.
(The format of our PDB-style files is described here.)

Timeline for d5f0fa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d5f0fa1