Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily) dimeric |
Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) |
Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins) |
Protein Class I MHC, alpha-1 and alpha-2 domains [54468] (29 species) |
Species Human (Homo sapiens), HLA-A2.1 [TaxId:9606] [54470] (103 PDB entries) Uniprot P01892 25-298 |
Domain d5eu3a1: 5eu3 A:1-181 [313817] Other proteins in same PDB: d5eu3a2, d5eu3b1, d5eu3b2 automated match to d1ogaa2 complexed with edo, gol |
PDB Entry: 5eu3 (more details), 1.97 Å
SCOPe Domain Sequences for d5eu3a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5eu3a1 d.19.1.1 (A:1-181) Class I MHC, alpha-1 and alpha-2 domains {Human (Homo sapiens), HLA-A2.1 [TaxId: 9606]} gshsmryfftsvsrpgrgeprfiavgyvddtqfvrfdsdaasqrmeprapwieqegpeyw dgetrkvkahsqthrvdlgtlrgyynqseagshtvqrmygcdvgsdwrflrgyhqyaydg kdyialkedlrswtaadmaaqttkhkweaahvaeqlraylegtcvewlrrylengketlq r
Timeline for d5eu3a1: