Lineage for d5eu3a1 (5eu3 A:1-181)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2544619Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 2544620Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) (S)
  5. 2544621Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)
  6. 2544723Protein Class I MHC, alpha-1 and alpha-2 domains [54468] (29 species)
  7. 2544763Species Human (Homo sapiens), HLA-A2.1 [TaxId:9606] [54470] (103 PDB entries)
    Uniprot P01892 25-298
  8. 2544860Domain d5eu3a1: 5eu3 A:1-181 [313817]
    Other proteins in same PDB: d5eu3a2, d5eu3b1, d5eu3b2
    automated match to d1ogaa2
    complexed with edo, gol

Details for d5eu3a1

PDB Entry: 5eu3 (more details), 1.97 Å

PDB Description: hla class i antigen
PDB Compounds: (A:) HLA class I histocompatibility antigen, A-2 alpha chain

SCOPe Domain Sequences for d5eu3a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5eu3a1 d.19.1.1 (A:1-181) Class I MHC, alpha-1 and alpha-2 domains {Human (Homo sapiens), HLA-A2.1 [TaxId: 9606]}
gshsmryfftsvsrpgrgeprfiavgyvddtqfvrfdsdaasqrmeprapwieqegpeyw
dgetrkvkahsqthrvdlgtlrgyynqseagshtvqrmygcdvgsdwrflrgyhqyaydg
kdyialkedlrswtaadmaaqttkhkweaahvaeqlraylegtcvewlrrylengketlq
r

SCOPe Domain Coordinates for d5eu3a1:

Click to download the PDB-style file with coordinates for d5eu3a1.
(The format of our PDB-style files is described here.)

Timeline for d5eu3a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d5eu3a2