| Class b: All beta proteins [48724] (178 folds) |
| Fold b.40: OB-fold [50198] (17 superfamilies) barrel, closed or partly opened n=5, S=10 or S=8; greek-key |
Superfamily b.40.2: Bacterial enterotoxins [50203] (3 families) ![]() |
| Family b.40.2.1: Bacterial AB5 toxins, B-subunits [50204] (7 proteins) |
| Protein Cholera toxin [50208] (2 species) barrel, partly opened; n*=5, S*=10 |
| Species Vibrio cholerae [TaxId:127906] [313713] (1 PDB entry) |
| Domain d5elde_: 5eld E: [313813] automated match to d1jr0d_ complexed with a2g, fuc, gal, gla, mes, na, ndg, peg, pge |
PDB Entry: 5eld (more details), 1.4 Å
SCOPe Domain Sequences for d5elde_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5elde_ b.40.2.1 (E:) Cholera toxin {Vibrio cholerae [TaxId: 127906]}
tpqnitdlcaeyhntqihtlndkifsyteslagkremaiitfkngatfqvevpgsqhids
qkkaiermkdtlriaylteakveklcvwnnktphaiaaisman
Timeline for d5elde_:
View in 3DDomains from other chains: (mouse over for more information) d5elda_, d5eldb_, d5eldc_, d5eldd_ |