![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily) sandwich; 12-14 strands in 2 sheets; complex topology |
![]() | Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families) ![]() |
![]() | Family b.29.1.1: Legume lectins [49900] (5 proteins) |
![]() | Protein automated matches [190035] (28 species) not a true protein |
![]() | Species Centrolobium tomentosum [TaxId:500182] [313810] (2 PDB entries) |
![]() | Domain d5eyya_: 5eyy A: [313811] automated match to d3zvxb_ complexed with ca, mn, nag |
PDB Entry: 5eyy (more details), 1.9 Å
SCOPe Domain Sequences for d5eyya_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5eyya_ b.29.1.1 (A:) automated matches {Centrolobium tomentosum [TaxId: 500182]} sdslsfsfinfdqdernviaqgdarisgnnilqltrtdsdgtpvrstvgrilysaqvrlw ekstnrvanfqsqfsfflesplsnpadgiaffiappdtaipsgsaggllglfspktaqne sanqvlavefdtfyaqnsntwdpnyphigidvnsiksaktvrwerregvtlnvlvtynps tktldvvatypdgqryqisvvvdvttvlpewvrvgfsaasgeqfqthnleswsftstll
Timeline for d5eyya_: