| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
Superfamily d.15.10: TGS-like [81271] (3 families) ![]() possibly related to the ubiquitin-like and MoaD/ThiS superfamilies; some similarity to the alpha-L RNA-binding motif |
| Family d.15.10.0: automated matches [227173] (1 protein) not a true family |
| Protein automated matches [226888] (3 species) not a true protein |
| Species Oryza sativa [TaxId:39947] [313621] (4 PDB entries) |
| Domain d5ee3b2: 5ee3 B:304-387 [313782] Other proteins in same PDB: d5ee3a1, d5ee3b1 automated match to d2ohfa2 complexed with anp, cl, epe, mg, so4 |
PDB Entry: 5ee3 (more details), 2.9 Å
SCOPe Domain Sequences for d5ee3b2:
Sequence; same for both SEQRES and ATOM records: (download)
>d5ee3b2 d.15.10.0 (B:304-387) automated matches {Oryza sativa [TaxId: 39947]}
liyfftagpdevkcwqirrqtkapqaagtihtdfergficaevmkfddlkelgsesavka
agkyrqegktyvvqdgdiiffkfn
Timeline for d5ee3b2: