Lineage for d1d4ge2 (1d4g E:2-189,E:353-431)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 21773Fold c.23: Flavodoxin-like [52171] (16 superfamilies)
  4. 22195Superfamily c.23.12: Formate/glycerate dehydrogenase catalytic domain-like [52283] (3 families) (S)
  5. 22228Family c.23.12.3: S-adenosylhomocystein hydrolase [52300] (1 protein)
  6. 22229Protein S-adenosylhomocystein hydrolase [52301] (2 species)
  7. 22233Species Rat (Rattus norvegicus) [TaxId:10116] [52303] (3 PDB entries)
  8. 22246Domain d1d4ge2: 1d4g E:2-189,E:353-431 [31378]
    Other proteins in same PDB: d1d4ga1, d1d4gb1, d1d4gc1, d1d4gd1, d1d4ge1, d1d4gf1, d1d4gg1, d1d4gh1

Details for d1d4ge2

PDB Entry: 1d4g (more details), 3 Å

PDB Description: crystal structure of s-adenosylhomocysteine hydrolase (adohcyase) complexed with a potent inhibitor d-eritadenine

SCOP Domain Sequences for d1d4ge2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1d4ge2 c.23.12.3 (E:2-189,E:353-431) S-adenosylhomocystein hydrolase {Rat (Rattus norvegicus)}
dklpykvadiglaawgrkaldiaenempglmrmremysaskplkgariagclhmtvetav
lietlvalgaevrwsscnifstqnhaaaaiakagipvfawkgetdeeylwcieqtlhfkd
gplnmilddggdltnlihtkhpqllsgirgiseetttgvhnlykmmangilkvpainvnd
svtkskfdXpsfvmsnsftnqvmaqielwthpdkypvgvhflpkkldeavaeahlgklnv
kltkltekqaqylgmpingpfkpdhyry

SCOP Domain Coordinates for d1d4ge2:

Click to download the PDB-style file with coordinates for d1d4ge2.
(The format of our PDB-style files is described here.)

Timeline for d1d4ge2: