Lineage for d5elda_ (5eld A:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2058098Fold b.40: OB-fold [50198] (16 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 2058419Superfamily b.40.2: Bacterial enterotoxins [50203] (3 families) (S)
  5. 2058420Family b.40.2.1: Bacterial AB5 toxins, B-subunits [50204] (7 proteins)
  6. 2058421Protein Cholera toxin [50208] (2 species)
    barrel, partly opened; n*=5, S*=10
  7. 2058422Species Vibrio cholerae [TaxId:127906] [313713] (1 PDB entry)
  8. 2058423Domain d5elda_: 5eld A: [313763]
    automated match to d1jr0d_
    complexed with a2g, fuc, gal, gla, mes, na, ndg, peg, pge

Details for d5elda_

PDB Entry: 5eld (more details), 1.4 Å

PDB Description: cholera toxin classical b-pentamer in complex with a lewis-y
PDB Compounds: (A:) Cholera enterotoxin B subunit

SCOPe Domain Sequences for d5elda_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5elda_ b.40.2.1 (A:) Cholera toxin {Vibrio cholerae [TaxId: 127906]}
tpqnitdlcaeyhntqihtlndkifsyteslagkremaiitfkngatfqvevpgsqhids
qkkaiermkdtlriaylteakveklcvwnnktphaiaaisman

SCOPe Domain Coordinates for d5elda_:

Click to download the PDB-style file with coordinates for d5elda_.
(The format of our PDB-style files is described here.)

Timeline for d5elda_: