SCOPe 2.06: Domain d5edgc_: 5edg C:

Lineage for d5edgc_ (5edg C:)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.211: HD-domain/PDEase-like [109603] (1 superfamily)
   multihelical; consists of two different alpha-helical bundles

4. Superfamily a.211.1: HD-domain/PDEase-like [109604] (6 families)

5. Family a.211.1.0: automated matches [191566] (1 protein)
   not a true family

6. Protein automated matches [190983] (9 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188676] (111 PDB entries)

8. Domain d5edgc_: 5edg C: [313752]
   Other proteins in same PDB: d5edgb2, d5edgd2
   automated match to d5axqb_
   complexed with 5mg, mg, zn

Details for d5edgc_

PDB Entry: 5edg, 2.3 Å

PDB Description: human pde10a in complex with 3-(2-chloro-5-phenyl-3h-imidazol-4-yl)-1- (3-trifluoromethoxy-phenyl)-1h-pyridazin-4-one at 2.30a

PDB Compounds: (C:) cAMP and cAMP-inhibited cGMP 3',5'-cyclic phosphodiesterase 10A

SCOPe Domain Sequences for d5edgc_:

Sequence; same for both SEQRES and ATOM records:

>d5edgc_ a.211.1.0 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
glmqftlpvrlcreielfhfdigpfenmwpgifvymvhrscgtscfeleklcrfimsvkk
nyrrvpyhnwkhavtvahcmyailqnnhtlftdlerkglliaclchdldhrgfsnsylqk
fdhplaalyststmeqhhfsqtvsilqleghnifstlssseyeqvleiirkaiiatdlal
yfgnrkqleemyqtgslnlnnqshrdrviglmmtacdlcsvtklwpvtkltandiyaefw
aegdemkklgiqpipmmdrdkkdevpqgqlgfynavaipcyttltqilpptepllkacrd
nlsqwekvirgee

Timeline for d5edgc_:

• d5edgc_ is new in SCOPe 2.06-stable
  
• d5edgc_ appears in SCOPe 2.07
  
• d5edgc_ appears in the current release, SCOPe 2.08