Lineage for d5dufa1 (5duf A:1-243)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2435650Fold c.14: ClpP/crotonase [52095] (1 superfamily)
    core: 4 turns of (beta-beta-alpha)n superhelix
  4. 2435651Superfamily c.14.1: ClpP/crotonase [52096] (5 families) (S)
  5. 2436644Family c.14.1.0: automated matches [191346] (1 protein)
    not a true family
  6. 2436645Protein automated matches [190246] (61 species)
    not a true protein
  7. 2436991Species Mycobacterium tuberculosis [TaxId:1773] [189677] (8 PDB entries)
  8. 2436992Domain d5dufa1: 5duf A:1-243 [313751]
    Other proteins in same PDB: d5dufa2
    automated match to d3he2a_
    complexed with g7a

Details for d5dufa1

PDB Entry: 5duf (more details), 1.5 Å

PDB Description: crystal structure of m. tuberculosis echa6 bound to ligand gsk729a
PDB Compounds: (A:) Probable enoyl-CoA hydratase echA6

SCOPe Domain Sequences for d5dufa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5dufa1 c.14.1.0 (A:1-243) automated matches {Mycobacterium tuberculosis [TaxId: 1773]}
migitqaeavltielqrperrnalnsqlveeltqairkagdgsaraivltgqgtafcaga
dlsgdafaadypdrlielhkamdaspmpvvgaingpaigaglqlamqcdlrvvapdaffq
fptskyglaldnwsirrlsslvghgraramllsaekltaeialhtgmanrigtladaqaw
aaeiarlaplaiqhakrvlnddgaieeawpahkelfdkawgsqdvieaqvarmekrppkf
qga

SCOPe Domain Coordinates for d5dufa1:

Click to download the PDB-style file with coordinates for d5dufa1.
(The format of our PDB-style files is described here.)

Timeline for d5dufa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d5dufa2