![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.40: OB-fold [50198] (17 superfamilies) barrel, closed or partly opened n=5, S=10 or S=8; greek-key |
![]() | Superfamily b.40.2: Bacterial enterotoxins [50203] (3 families) ![]() |
![]() | Family b.40.2.1: Bacterial AB5 toxins, B-subunits [50204] (7 proteins) |
![]() | Protein Cholera toxin [50208] (2 species) barrel, partly opened; n*=5, S*=10 |
![]() | Species Vibrio cholerae [TaxId:127906] [313713] (1 PDB entry) |
![]() | Domain d5eldc_: 5eld C: [313749] automated match to d1jr0d_ complexed with gal, gla, mes, na, peg, pge |
PDB Entry: 5eld (more details), 1.4 Å
SCOPe Domain Sequences for d5eldc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5eldc_ b.40.2.1 (C:) Cholera toxin {Vibrio cholerae [TaxId: 127906]} tpqnitdlcaeyhntqihtlndkifsyteslagkremaiitfkngatfqvevpgsqhids qkkaiermkdtlriaylteakveklcvwnnktphaiaaisman
Timeline for d5eldc_:
![]() Domains from other chains: (mouse over for more information) d5elda_, d5eldb_, d5eldd_, d5elde_ |