Lineage for d5d7jc2 (5d7j C:179-269)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2754035Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2754036Protein automated matches [190740] (31 species)
    not a true protein
  7. 2754280Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)
  8. 2755840Domain d5d7jc2: 5d7j C:179-269 [313748]
    Other proteins in same PDB: d5d7ja2, d5d7jc1, d5d7jd_, d5d7je1, d5d7jf1, d5d7jf2, d5d7jg2
    automated match to d4l4va2
    complexed with 2lj, gol

Details for d5d7jc2

PDB Entry: 5d7j (more details), 1.97 Å

PDB Description: structure of human mr1-5-op-ru in complex with human mait m33.64(y95alphaf) tcr
PDB Compounds: (C:) Major histocompatibility complex class I-related gene protein

SCOPe Domain Sequences for d5d7jc2:

Sequence, based on SEQRES records: (download)

>d5d7jc2 b.1.1.0 (C:179-269) automated matches {Human (Homo sapiens) [TaxId: 9606]}
tepplvrvnrketfpgvtalfckahgfyppeiymtwmkngeeivqeidygdilpsgdgty
qawasieldpqssnlyschvehsgvhmvlqv

Sequence, based on observed residues (ATOM records): (download)

>d5d7jc2 b.1.1.0 (C:179-269) automated matches {Human (Homo sapiens) [TaxId: 9606]}
tepplvrvnrketfpgvtalfckahgfyppeiymtwmkngeeivqeidygdilpsgdgty
qawasiellyschvehsgvhmvlqv

SCOPe Domain Coordinates for d5d7jc2:

Click to download the PDB-style file with coordinates for d5d7jc2.
(The format of our PDB-style files is described here.)

Timeline for d5d7jc2: