Lineage for d5elca_ (5elc A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2787872Fold b.40: OB-fold [50198] (17 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 2788203Superfamily b.40.2: Bacterial enterotoxins [50203] (3 families) (S)
  5. 2788204Family b.40.2.1: Bacterial AB5 toxins, B-subunits [50204] (7 proteins)
  6. 2788746Protein automated matches [190381] (11 species)
    not a true protein
  7. 2788887Species Vibrio cholerae [TaxId:243277] [313678] (4 PDB entries)
  8. 2788898Domain d5elca_: 5elc A: [313737]
    automated match to d1jr0d_
    complexed with bcn, ca, fuc

Details for d5elca_

PDB Entry: 5elc (more details), 1.5 Å

PDB Description: cholera toxin el tor b-pentamer in complex with lewis-y
PDB Compounds: (A:) Cholera enterotoxin subunit B

SCOPe Domain Sequences for d5elca_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5elca_ b.40.2.1 (A:) automated matches {Vibrio cholerae [TaxId: 243277]}
tpqnitdlcaeyhntqiytlndkifsyteslagkremaiitfkngaifqvevpgsqhids
qkkaiermkdtlriaylteakveklcvwnnktphaiaaisman

SCOPe Domain Coordinates for d5elca_:

Click to download the PDB-style file with coordinates for d5elca_.
(The format of our PDB-style files is described here.)

Timeline for d5elca_: