SCOPe 2.08: Domain d5ee0a2: 5ee0 A:304-387

Lineage for d5ee0a2 (5ee0 A:304-387)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.10: TGS-like [81271] (3 families)
   possibly related to the ubiquitin-like and MoaD/ThiS superfamilies; some similarity to the alpha-L RNA-binding motif

5. Family d.15.10.0: automated matches [227173] (1 protein)
   not a true family

6. Protein automated matches [226888] (3 species)
   not a true protein

7. Species Oryza sativa [TaxId:39947] [313621] (4 PDB entries)

8. Domain d5ee0a2: 5ee0 A:304-387 [313734]
   Other proteins in same PDB: d5ee0a1
   automated match to d2ohfa2

Details for d5ee0a2

PDB Entry: 5ee0, 2.2 Å

PDB Description: crystal structure of osychf1 at ph 6.5

PDB Compounds: (A:) Obg-like ATPase 1

SCOPe Domain Sequences for d5ee0a2:

Sequence; same for both SEQRES and ATOM records:

>d5ee0a2 d.15.10.0 (A:304-387) automated matches {Oryza sativa [TaxId: 39947]}
liyfftagpdevkcwqirrqtkapqaagtihtdfergficaevmkfddlkelgsesavka
agkyrqegktyvvqdgdiiffkfn

Timeline for d5ee0a2:

• d5ee0a2 first appeared in SCOPe 2.06
  
• d5ee0a2 appears in SCOPe 2.07