| Class b: All beta proteins [48724] (180 folds) |
| Fold b.40: OB-fold [50198] (17 superfamilies) barrel, closed or partly opened n=5, S=10 or S=8; greek-key |
Superfamily b.40.2: Bacterial enterotoxins [50203] (3 families) ![]() |
| Family b.40.2.1: Bacterial AB5 toxins, B-subunits [50204] (7 proteins) |
| Protein automated matches [190381] (11 species) not a true protein |
| Species Vibrio cholerae [TaxId:127906] [313688] (2 PDB entries) |
| Domain d5eleg_: 5ele G: [313728] automated match to d1jr0d_ complexed with 1pe, bcn, ca, fuc, nag |
PDB Entry: 5ele (more details), 1.6 Å
SCOPe Domain Sequences for d5eleg_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5eleg_ b.40.2.1 (G:) automated matches {Vibrio cholerae [TaxId: 127906]}
tpqnitdlcaeyhntqiytlndkifsyteslagkremaiitfkngaifqvevpgsqhids
qkkaiermkdtlriaylteakveklcvwnnktphaiaaisman
Timeline for d5eleg_: