SCOPe 2.07: Domain d5edec_: 5ede C:

Lineage for d5edec_ (5ede C:)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.211: HD-domain/PDEase-like [109603] (1 superfamily)
   multihelical; consists of two different alpha-helical bundles

4. Superfamily a.211.1: HD-domain/PDEase-like [109604] (6 families)

5. Family a.211.1.0: automated matches [191566] (1 protein)
   not a true family

6. Protein automated matches [190983] (10 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188676] (136 PDB entries)

8. Domain d5edec_: 5ede C: [313712]
   Other proteins in same PDB: d5edeb2, d5edeb3, d5eded2
   automated match to d5axqb_
   complexed with 5m6, gol, mg, zn

Details for d5edec_

PDB Entry: 5ede, 2.2 Å

PDB Description: human pde10a in complex with 1-(4-chloro-phenyl)-3-methyl-1h-thieno[2, 3-c]pyrazole-5-carboxylic acid (tetrahydro-furan-2-ylmethyl)-amide at 2.2a

PDB Compounds: (C:) cAMP and cAMP-inhibited cGMP 3',5'-cyclic phosphodiesterase 10A

SCOPe Domain Sequences for d5edec_:

Sequence; same for both SEQRES and ATOM records:

>d5edec_ a.211.1.0 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
glmqftlpvrlcreielfhfdigpfenmwpgifvymvhrscgtscfeleklcrfimsvkk
nyrrvpyhnwkhavtvahcmyailqnnhtlftdlerkglliaclchdldhrgfsnsylqk
fdhplaalyststmeqhhfsqtvsilqleghnifstlssseyeqvleiirkaiiatdlal
yfgnrkqleemyqtgslnlnnqshrdrviglmmtacdlcsvtklwpvtkltandiyaefw
aegdemkklgiqpipmmdrdkkdevpqgqlgfynavaipcyttltqilpptepllkacrd
nlsqwekvirgee

Timeline for d5edec_:

• d5edec_ first appeared in SCOPe 2.06
  
• d5edec_ appears in the current release, SCOPe 2.08