SCOPe 2.05: Domain d1d4fb2: 1d4f B:2-189,B:353-431

Lineage for d1d4fb2 (1d4f B:2-189,B:353-431)

Root: SCOPe 2.05
Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
Superfamily c.23.12: Formate/glycerate dehydrogenase catalytic domain-like [52283] (3 families)
Family c.23.12.3: S-adenosylhomocystein hydrolase [52300] (1 protein)
Protein S-adenosylhomocystein hydrolase [52301] (3 species)
contains additional secondary structures disguising the superfamily fold
Species Norway rat (Rattus norvegicus) [TaxId:10116] [52303] (7 PDB entries)
Domain d1d4fb2: 1d4f B:2-189,B:353-431 [31371]
Other proteins in same PDB: d1d4fa1, d1d4fb1, d1d4fc1, d1d4fd1
complexed with adn, nad; mutant

Details for d1d4fb2

PDB Entry: 1d4f (more details), 2.8 Å

PDB Description: crystal structure of recombinant rat-liver d244e mutant s- adenosylhomocysteine hydrolase

PDB Compounds: (B:) s-adenosylhomocysteine hydrolase

SCOPe Domain Sequences for d1d4fb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1d4fb2 c.23.12.3 (B:2-189,B:353-431) S-adenosylhomocystein hydrolase {Norway rat (Rattus norvegicus) [TaxId: 10116]}
dklpykvadiglaawgrkaldiaenempglmrmremysaskplkgariagclhmtvetav
lietlvalgaevrwsscnifstqdhaaaaiakagipvfawkgetdeeylwcieqtlhfkd
gplnmilddggdltnlihtkhpqllsgirgiseetttgvhnlykmmangilkvpainvnd
svtkskfdXpsfvmsnsftnqvmaqielwthpdkypvgvhflpkkldeavaeahlgklnv
kltkltekqaqylgmpingpfkpdhyry

SCOPe Domain Coordinates for d1d4fb2:

Click to download the PDB-style file with coordinates for d1d4fb2.
(The format of our PDB-style files is described here.)

Timeline for d1d4fb2: