Lineage for d5dyzc_ (5dyz C:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2330957Fold a.104: Cytochrome P450 [48263] (1 superfamily)
    multihelical
  4. 2330958Superfamily a.104.1: Cytochrome P450 [48264] (2 families) (S)
  5. 2330959Family a.104.1.1: Cytochrome P450 [48265] (23 protein domains)
  6. 2331061Protein Cytochrome P450 bm-3 [48268] (2 species)
  7. 2331085Species Bacillus megaterium [TaxId:1404] [48269] (76 PDB entries)
    Uniprot P14779
  8. 2331201Domain d5dyzc_: 5dyz C: [313708]
    automated match to d2uwha_
    complexed with 140, hem; mutant

Details for d5dyzc_

PDB Entry: 5dyz (more details), 1.97 Å

PDB Description: crystal structure of asp251gly/gln307his mutant of cytochrome p450 bm3 in complex with n-palmitoylglycine
PDB Compounds: (C:) Bifunctional P-450/NADPH-P450 reductase

SCOPe Domain Sequences for d5dyzc_:

Sequence, based on SEQRES records: (download)

>d5dyzc_ a.104.1.1 (C:) Cytochrome P450 bm-3 {Bacillus megaterium [TaxId: 1404]}
ikempqpktfgelknlpllntdkpvqalmkiadelgeifkfeapgrvtrylssqrlikea
cdesrfdknlsqalkfvrdfagdglftswtheknwkkahnillpsfsqqamkgyhammvd
iavqlvqkwerlnadehievpedmtrltldtiglcgfnyrfnsfyrdqphpfitsmvral
deamnklqranpddpaydenkrqfqedikvmndlvdkiiadrkasgeqsddllthmlngk
dpetgepldgeniryqiitfliaghettsgllsfalyflvknphvlqkaaeeaarvlvdp
vpsykhvkqlkyvgmvlnealrlwptapafslyakedtvlggeyplekgdelmvlipqlh
rdktiwgddveefrperfenpsaipqhafkpfgngqracigqqfalheatlvlgmmlkhf
dfedhtnyeldiketltlkpegfvvkakskkipl

Sequence, based on observed residues (ATOM records): (download)

>d5dyzc_ a.104.1.1 (C:) Cytochrome P450 bm-3 {Bacillus megaterium [TaxId: 1404]}
ikempqpktfgelknlpllntdkpvqalmkiadelgeifkfeapgrvtrylssqrlikea
cdesrfdknlsqalkfvrdfagdglftswtheknwkkahnillpsfsqqamkgyhammvd
iavqlvqkwerlnadehievpedmtrltldtiglcgfnyrfnsfyrdqphpfitsmvral
deamnklqranpddpaydenkrqfqedikvmndlvdkiiadrkasgqsddllthmlngkd
petgepldgeniryqiitfliaghettsgllsfalyflvknphvlqkaaeeaarvlvdpv
psykhvkqlkyvgmvlnealrlwptapafslyakedtvlggeyplekgdelmvlipqlhr
dktiwgddveefrperfenpsaipqhafkpfgngqracigqqfalheatlvlgmmlkhfd
fedhtnyeldiketltlkpegfvvkakskkipl

SCOPe Domain Coordinates for d5dyzc_:

Click to download the PDB-style file with coordinates for d5dyzc_.
(The format of our PDB-style files is described here.)

Timeline for d5dyzc_: