SCOPe 2.08: Domain d5edhb1: 5edh B:458-770

Lineage for d5edhb1 (5edh B:458-770)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.211: HD-domain/PDEase-like [109603] (1 superfamily)
   multihelical; consists of two different alpha-helical bundles

4. Superfamily a.211.1: HD-domain/PDEase-like [109604] (9 families)

5. Family a.211.1.0: automated matches [191566] (1 protein)
   not a true family

6. Protein automated matches [190983] (12 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188676] (139 PDB entries)

8. Domain d5edhb1: 5edh B:458-770 [313704]
   Other proteins in same PDB: d5edhb2, d5edhb3, d5edhd2
   automated match to d5axqb_
   complexed with 5mf, mg, zn

Details for d5edhb1

PDB Entry: 5edh, 2.03 Å

PDB Description: human pde10a, 8-ethyl-5-methyl-2-[2-(2-methyl-5-pyrrolidin-1-yl-1,2,4- triazol-3-yl)ethyl]-[1,2,4]triazolo[1,5-c]pyrimidine, 2.03a, h3, rfree=22.7%

PDB Compounds: (B:) cAMP and cAMP-inhibited cGMP 3',5'-cyclic phosphodiesterase 10A

SCOPe Domain Sequences for d5edhb1:

Sequence; same for both SEQRES and ATOM records:

>d5edhb1 a.211.1.0 (B:458-770) automated matches {Human (Homo sapiens) [TaxId: 9606]}
glmqftlpvrlckeielfhfdigpfenmwpgifvymvhrscgtscfeleklcrfimsvkk
nyrrvpyhnwkhavtvahcmyailqnnhtlftdlerkglliaclchdldhrgfsnsylqk
fdhplaalyststmeqhhfsqtvsilqleghnifstlssseyeqvleiirkaiiatdlal
yfgnrkqleemyqtgslnlnnqshrdrviglmmtacdlcsvtklwpvtkltandiyaefw
aegdemkklgiqpipmmdrdkkdevpqgqlgfynavaipcyttltqilpptepllkacrd
nlsqwekvirgee

Timeline for d5edhb1:

• d5edhb1 first appeared in SCOPe 2.06, called d5edhb_
  
• d5edhb1 appears in SCOPe 2.07