Lineage for d5dqpa_ (5dqp A:)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2413227Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2424945Superfamily c.1.16: Bacterial luciferase-like [51679] (5 families) (S)
    consists of clearly related families of somewhat different folds
  5. 2424999Family c.1.16.0: automated matches [191510] (1 protein)
    not a true family
  6. 2425000Protein automated matches [190849] (8 species)
    not a true protein
  7. 2425012Species Edta-degrading bacterium [TaxId:85561] [313702] (1 PDB entry)
  8. 2425013Domain d5dqpa_: 5dqp A: [313703]
    automated match to d3sdob_
    complexed with pe4, so4

Details for d5dqpa_

PDB Entry: 5dqp (more details), 2.15 Å

PDB Description: edta monooxygenase (emoa) from chelativorans sp. bnc1
PDB Compounds: (A:) EDTA monooxygenase

SCOPe Domain Sequences for d5dqpa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5dqpa_ c.1.16.0 (A:) automated matches {Edta-degrading bacterium [TaxId: 85561]}
rrmylvswlnssgvlpnswnegrgnrarifdlenyirsaeiarrgridaffladqpqltp
npkvrpeypfdpivlaaaitgrvpdiggivtastsfslpytlarqiasvnllsggrigwn
avttanpavaanygaaiathdnryeraeeflevvhglwnswkfpwdeaigpnpnpfgevm
pinhegkyfkvagplnvplppygppvvvqaggsdqgkrlasrfgeiiyaflgskpagrrf
vaearaaaraqgrpegstlvlpsfvpligsteaevkrlvaeyeagldpaeqriealskql
gidlerinvdqvlqekdfnlpkesatpigilksmvdvaldeklslrqlalrmrliagtpd
qvadrlidwwqdeaadgfvinapllpdaleifvdqvvpilqsrgvfprsytestlrerlg
lprnplg

SCOPe Domain Coordinates for d5dqpa_:

Click to download the PDB-style file with coordinates for d5dqpa_.
(The format of our PDB-style files is described here.)

Timeline for d5dqpa_: