Lineage for d1d4fa2 (1d4f A:2-189,A:353-431)
- Root: SCOPe 2.07
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
Superfamily c.23.12: Formate/glycerate dehydrogenase catalytic domain-like [52283] (3 families) 
Family c.23.12.3: S-adenosylhomocystein hydrolase [52300] (1 protein) Protein S-adenosylhomocystein hydrolase [52301] (3 species)
contains additional secondary structures disguising the superfamily fold
Species Norway rat (Rattus norvegicus) [TaxId:10116] [52303] (7 PDB entries) 
Domain d1d4fa2: 1d4f A:2-189,A:353-431 [31370]
Other proteins in same PDB: d1d4fa1, d1d4fb1, d1d4fc1, d1d4fd1
complexed with adn, nad; mutant
Details for d1d4fa2
PDB Entry: 1d4f (more details), 2.8 Å
PDB Description: crystal structure of recombinant rat-liver d244e mutant s- adenosylhomocysteine hydrolase
PDB Compounds: (A:) s-adenosylhomocysteine hydrolaseSCOPe Domain Sequences for d1d4fa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1d4fa2 c.23.12.3 (A:2-189,A:353-431) S-adenosylhomocystein hydrolase {Norway rat (Rattus norvegicus) [TaxId: 10116]}
dklpykvadiglaawgrkaldiaenempglmrmremysaskplkgariagclhmtvetav
lietlvalgaevrwsscnifstqdhaaaaiakagipvfawkgetdeeylwcieqtlhfkd
gplnmilddggdltnlihtkhpqllsgirgiseetttgvhnlykmmangilkvpainvnd
svtkskfdXpsfvmsnsftnqvmaqielwthpdkypvgvhflpkkldeavaeahlgklnv
kltkltekqaqylgmpingpfkpdhyry
SCOPe Domain Coordinates for d1d4fa2:
Click to download the PDB-style file with coordinates for d1d4fa2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1d4fa2:
View in 3D
