Class b: All beta proteins [48724] (177 folds) |
Fold b.40: OB-fold [50198] (16 superfamilies) barrel, closed or partly opened n=5, S=10 or S=8; greek-key |
Superfamily b.40.2: Bacterial enterotoxins [50203] (3 families) |
Family b.40.2.1: Bacterial AB5 toxins, B-subunits [50204] (7 proteins) |
Protein Cholera toxin [50208] (2 species) barrel, partly opened; n*=5, S*=10 |
Species Vibrio cholerae [TaxId:666] [50209] (26 PDB entries) Uniprot P01556 22-124 |
Domain d5elbi_: 5elb I: [313697] automated match to d1jr0d_ complexed with bcn, ca, fuc, gal, gla, nag, ndg, peg |
PDB Entry: 5elb (more details), 1.08 Å
SCOPe Domain Sequences for d5elbi_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5elbi_ b.40.2.1 (I:) Cholera toxin {Vibrio cholerae [TaxId: 666]} tpqnitdlcaeyhntqihtlndkifsyteslagkremaiitfkngatfqvevpgsqhids qkkaiermkdtlriaylteakveklcvwnnktphaiaaisman
Timeline for d5elbi_: