SCOPe 2.08: Domain d5dtzc1: 5dtz C:3-232

Lineage for d5dtzc1 (5dtz C:3-232)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.22: GFP-like [54510] (1 superfamily)
   beta-sheet folds into a barrel (n=11, S=14) around the central helix

4. Superfamily d.22.1: GFP-like [54511] (3 families)

5. Family d.22.1.1: Fluorescent proteins [54512] (6 proteins)

6. Protein Green fluorescent protein, GFP [54513] (6 species)

7. Species Jellyfish (Aequorea victoria) [TaxId:6100] [54514] (285 PDB entries)
   Uniprot P42212

8. Domain d5dtzc1: 5dtz C:3-232 [313694]
   Other proteins in same PDB: d5dtza2, d5dtzb2, d5dtzc2, d5dtzd2
   automated match to d3st3a_
   complexed with peg

Details for d5dtzc1

PDB Entry: 5dtz, 1.5 Å

PDB Description: crystal structure of rsfolder in the fluorescent on-state

PDB Compounds: (C:) Green fluorescent protein

SCOPe Domain Sequences for d5dtzc1:

Sequence; same for both SEQRES and ATOM records:

>d5dtzc1 d.22.1.1 (C:3-232) Green fluorescent protein, GFP {Jellyfish (Aequorea victoria) [TaxId: 6100]}
skgeelftgvvpilveldgdvnghkfsvrgegegdatngkltlkficttgklpvpwptlv
ttlxvlcfsrypdhmkrhdffksampegyvqertisfkddgtyktraevkfegdtlvnri
elkgidfkedgnilghkleynfnshnvyitadkqkngiksnfkirhnvedgsvqladhyq
qntpigdgpvllpdnhylstqsklskdpnekrdhmvllefvtaagith

Timeline for d5dtzc1:

• d5dtzc1 first appeared in SCOPe 2.06
  
• d5dtzc1 appears in SCOPe 2.07