Lineage for d5dvoa1 (5dvo A:234-339)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2352460Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2356941Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2359879Protein Immunoglobulin heavy chain gamma constant domain 2, CH2-gamma [88584] (4 species)
  7. 2359880Species Human (Homo sapiens) [TaxId:9606] [88585] (61 PDB entries)
    Uniprot P01857 #118-327 ! Uniprot P01857 118-327 # GC1_HUMAN Ig gamma-1 chain C region
  8. 2359949Domain d5dvoa1: 5dvo A:234-339 [313690]
    Other proteins in same PDB: d5dvoa2, d5dvob2
    automated match to d1hzhh3
    complexed with so4

Details for d5dvoa1

PDB Entry: 5dvo (more details), 2.5 Å

PDB Description: fc k392d/k409d homodimer
PDB Compounds: (A:) Ig gamma-1 chain C region

SCOPe Domain Sequences for d5dvoa1:

Sequence, based on SEQRES records: (download)

>d5dvoa1 b.1.1.2 (A:234-339) Immunoglobulin heavy chain gamma constant domain 2, CH2-gamma {Human (Homo sapiens) [TaxId: 9606]}
llggpsvflfppkpkdtlmisrtpevtcvvvdvshedpevkfnwyvdgvevhnaktkpre
eqynstyrvvsvltvlhqdwlngkeykckvsnkalpapiektiska

Sequence, based on observed residues (ATOM records): (download)

>d5dvoa1 b.1.1.2 (A:234-339) Immunoglobulin heavy chain gamma constant domain 2, CH2-gamma {Human (Homo sapiens) [TaxId: 9606]}
llggpsvflfppkpkdtlmisrtpevtcvvvdvshedpevkfnwyvdgvevhnkpreeqy
nstyrvvsvltvlhqdwlngkeykckvsnkalpapiektiska

SCOPe Domain Coordinates for d5dvoa1:

Click to download the PDB-style file with coordinates for d5dvoa1.
(The format of our PDB-style files is described here.)

Timeline for d5dvoa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d5dvoa2