Lineage for d5edid_ (5edi D:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2018901Fold a.211: HD-domain/PDEase-like [109603] (1 superfamily)
    multihelical; consists of two different alpha-helical bundles
  4. 2018902Superfamily a.211.1: HD-domain/PDEase-like [109604] (6 families) (S)
  5. 2019338Family a.211.1.0: automated matches [191566] (1 protein)
    not a true family
  6. 2019339Protein automated matches [190983] (9 species)
    not a true protein
  7. 2019353Species Human (Homo sapiens) [TaxId:9606] [188676] (111 PDB entries)
  8. 2019556Domain d5edid_: 5edi D: [313686]
    Other proteins in same PDB: d5edib2
    automated match to d4hf4a_
    complexed with 5m9, mg, zn

Details for d5edid_

PDB Entry: 5edi (more details), 2.2 Å

PDB Description: human pde10a, 6-chloro-5,8-dimethyl-2-[2-(2-methyl-5-pyrrolidin-1-yl- 2h-[1,2,4]triazol-3-yl)-ethyl]-[1,2,4]triazolo[1,5-a]pyridine, 2.20a, h3, rfree=23.5%
PDB Compounds: (D:) cAMP and cAMP-inhibited cGMP 3',5'-cyclic phosphodiesterase 10A

SCOPe Domain Sequences for d5edid_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5edid_ a.211.1.0 (D:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
tseewqglmqftlpvrlcreielfhfdigpfenmwpgifvymvhrscgtscfeleklcrf
imsvkknyrrvpyhnwkhavtvahcmyailqnnhtlftdlerkglliaclchdldhrgfs
nsylqkfdhplaalyststmeqhhfsqtvsilqleghnifstlssseyeqvleiirkaii
atdlalyfgnrkqleemyqtgslnlnnqshrdrviglmmtacdlcsvtklwpvtkltand
iyaefwaegdemkklgiqpipmmdrdkkdevpqgqlgfynavaipcyttltqilpptepl
lkacrdnlsqwekvirg

SCOPe Domain Coordinates for d5edid_:

Click to download the PDB-style file with coordinates for d5edid_.
(The format of our PDB-style files is described here.)

Timeline for d5edid_: