Lineage for d5edhc_ (5edh C:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2736615Fold a.211: HD-domain/PDEase-like [109603] (1 superfamily)
    multihelical; consists of two different alpha-helical bundles
  4. 2736616Superfamily a.211.1: HD-domain/PDEase-like [109604] (9 families) (S)
  5. 2737183Family a.211.1.0: automated matches [191566] (1 protein)
    not a true family
  6. 2737184Protein automated matches [190983] (12 species)
    not a true protein
  7. 2737203Species Human (Homo sapiens) [TaxId:9606] [188676] (139 PDB entries)
  8. 2737391Domain d5edhc_: 5edh C: [313682]
    Other proteins in same PDB: d5edhb2, d5edhb3, d5edhd2
    automated match to d5axqb_
    complexed with 5mf, mg, zn

Details for d5edhc_

PDB Entry: 5edh (more details), 2.03 Å

PDB Description: human pde10a, 8-ethyl-5-methyl-2-[2-(2-methyl-5-pyrrolidin-1-yl-1,2,4- triazol-3-yl)ethyl]-[1,2,4]triazolo[1,5-c]pyrimidine, 2.03a, h3, rfree=22.7%
PDB Compounds: (C:) cAMP and cAMP-inhibited cGMP 3',5'-cyclic phosphodiesterase 10A

SCOPe Domain Sequences for d5edhc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5edhc_ a.211.1.0 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
glmqftlpvrlckeielfhfdigpfenmwpgifvymvhrscgtscfeleklcrfimsvkk
nyrrvpyhnwkhavtvahcmyailqnnhtlftdlerkglliaclchdldhrgfsnsylqk
fdhplaalyststmeqhhfsqtvsilqleghnifstlssseyeqvleiirkaiiatdlal
yfgnrkqleemyqtgslnlnnqshrdrviglmmtacdlcsvtklwpvtkltandiyaefw
aegdemkklgiqpipmmdrdkkdevpqgqlgfynavaipcyttltqilpptepllkacrd
nlsqwekvirgee

SCOPe Domain Coordinates for d5edhc_:

Click to download the PDB-style file with coordinates for d5edhc_.
(The format of our PDB-style files is described here.)

Timeline for d5edhc_: