Lineage for d5du8c1 (5du8 C:1-243)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2435650Fold c.14: ClpP/crotonase [52095] (1 superfamily)
    core: 4 turns of (beta-beta-alpha)n superhelix
  4. 2435651Superfamily c.14.1: ClpP/crotonase [52096] (5 families) (S)
  5. 2436644Family c.14.1.0: automated matches [191346] (1 protein)
    not a true family
  6. 2436645Protein automated matches [190246] (57 species)
    not a true protein
  7. 2436991Species Mycobacterium tuberculosis [TaxId:1773] [189677] (8 PDB entries)
  8. 2436999Domain d5du8c1: 5du8 C:1-243 [313680]
    Other proteins in same PDB: d5du8a2, d5du8b2, d5du8c2
    automated match to d3he2a_
    complexed with 5fk

Details for d5du8c1

PDB Entry: 5du8 (more details), 2.23 Å

PDB Description: crystal structure of m. tuberculosis echa6 bound to gsk572a
PDB Compounds: (C:) Probable enoyl-CoA hydratase echA6

SCOPe Domain Sequences for d5du8c1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5du8c1 c.14.1.0 (C:1-243) automated matches {Mycobacterium tuberculosis [TaxId: 1773]}
migitqaeavltielqrperrnalnsqlveeltqairkagdgsaraivltgqgtafcaga
dlsgdafaadypdrlielhkamdaspmpvvgaingpaigaglqlamqcdlrvvapdaffq
fptskyglaldnwsirrlsslvghgraramllsaekltaeialhtgmanrigtladaqaw
aaeiarlaplaiqhakrvlnddgaieeawpahkelfdkawgsqdvieaqvarmekrppkf
qga

SCOPe Domain Coordinates for d5du8c1:

Click to download the PDB-style file with coordinates for d5du8c1.
(The format of our PDB-style files is described here.)

Timeline for d5du8c1: