Lineage for d1b3rc2 (1b3r C:4-189,C:353-431)
- Root: SCOP 1.57
Class c: Alpha and beta proteins (a/b) [51349] (107 folds) 
Fold c.23: Flavodoxin-like [52171] (17 superfamilies) 
Superfamily c.23.12: Formate/glycerate dehydrogenase catalytic domain-like [52283] (3 families) 
Family c.23.12.3: S-adenosylhomocystein hydrolase [52300] (1 protein) Protein S-adenosylhomocystein hydrolase [52301] (2 species) Species Rat (Rattus norvegicus) [TaxId:10116] [52303] (3 PDB entries) 
Domain d1b3rc2: 1b3r C:4-189,C:353-431 [31368]
Other proteins in same PDB: d1b3ra1, d1b3rb1, d1b3rc1, d1b3rd1
Details for d1b3rc2
PDB Entry: 1b3r (more details), 2.8 Å
PDB Description: rat liver s-adenosylhomocystein hydrolase
SCOP Domain Sequences for d1b3rc2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1b3rc2 c.23.12.3 (C:4-189,C:353-431) S-adenosylhomocystein hydrolase {Rat (Rattus norvegicus)}
lpykvadiglaawgrkaldiaenempglmrmremysaskplkgariagclhmtvetavli
etlvalgaevrwsscnifstqdhaaaaiakagipvfawkgetdeeylwcieqtlhfkdgp
lnmilddggdltnlihtkhpqllsgirgiseetttgvhnlykmmangilkvpainvndsv
tkskfdXpsfvmsnsftnqvmaqielwthpdkypvgvhflpkkldeavaeahlgklnvkl
tkltekqaqylgmpingpfkpdhyry
SCOP Domain Coordinates for d1b3rc2:
Click to download the PDB-style file with coordinates for d1b3rc2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1b3rc2:
View in 3D
