| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.14: ClpP/crotonase [52095] (1 superfamily) core: 4 turns of (beta-beta-alpha)n superhelix |
Superfamily c.14.1: ClpP/crotonase [52096] (5 families) ![]() |
| Family c.14.1.0: automated matches [191346] (1 protein) not a true family |
| Protein automated matches [190246] (71 species) not a true protein |
| Species Mycobacterium tuberculosis [TaxId:1773] [189677] (9 PDB entries) |
| Domain d5duca1: 5duc A:1-243 [313670] Other proteins in same PDB: d5duca2, d5ducb2, d5ducc2 automated match to d3he2a_ complexed with g51 |
PDB Entry: 5duc (more details), 2.7 Å
SCOPe Domain Sequences for d5duca1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5duca1 c.14.1.0 (A:1-243) automated matches {Mycobacterium tuberculosis [TaxId: 1773]}
migitqaeavltielqrperrnalnsqlveeltqairkagdgsaraivltgqgtafcaga
dlsgdafaadypdrlielhkamdaspmpvvgaingpaigaglqlamqcdlrvvapdaffq
fptskyglaldnwsirrlsslvghgraramllsaekltaeialhtgmanrigtladaqaw
aaeiarlaplaiqhakrvlnddgaieeawpahkelfdkawgsqdvieaqvarmekrppkf
qga
Timeline for d5duca1:
View in 3DDomains from other chains: (mouse over for more information) d5ducb1, d5ducb2, d5ducc1, d5ducc2 |