Lineage for d5ea1a_ (5ea1 A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2706693Fold a.29: Bromodomain-like [47363] (15 superfamilies)
    4 helices; bundle; minor mirror variant of up-and-down topology
  4. 2706694Superfamily a.29.2: Bromodomain [47370] (2 families) (S)
  5. 2706927Family a.29.2.0: automated matches [191428] (1 protein)
    not a true family
  6. 2706928Protein automated matches [190615] (15 species)
    not a true protein
  7. 2706959Species Human (Homo sapiens) [TaxId:9606] [187641] (1052 PDB entries)
  8. 2708060Domain d5ea1a_: 5ea1 A: [313657]
    automated match to d2grca_
    complexed with mpd, mrd

Details for d5ea1a_

PDB Entry: 5ea1 (more details), 2 Å

PDB Description: crystal structure of smarca4 bromodomain in complex with mpd
PDB Compounds: (A:) Transcription activator BRG1

SCOPe Domain Sequences for d5ea1a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ea1a_ a.29.2.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
spnppnltkkmkkivdavikykdsssgrqlsevfiqlpsrkelpeyyelirkpvdfkkik
erirnhkyrslndlekdvmllcqnaqtfnlegsliyedsivlqsvftsvrqkie

SCOPe Domain Coordinates for d5ea1a_:

Click to download the PDB-style file with coordinates for d5ea1a_.
(The format of our PDB-style files is described here.)

Timeline for d5ea1a_: