Lineage for d5e9zd_ (5e9z D:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2330957Fold a.104: Cytochrome P450 [48263] (1 superfamily)
    multihelical
  4. 2330958Superfamily a.104.1: Cytochrome P450 [48264] (2 families) (S)
  5. 2330959Family a.104.1.1: Cytochrome P450 [48265] (23 protein domains)
  6. 2331061Protein Cytochrome P450 bm-3 [48268] (2 species)
  7. 2331085Species Bacillus megaterium [TaxId:1404] [48269] (76 PDB entries)
    Uniprot P14779
  8. 2331222Domain d5e9zd_: 5e9z D: [313650]
    Other proteins in same PDB: d5e9zc2
    automated match to d2uwha_
    complexed with dtt, fe2, pp9; mutant

Details for d5e9zd_

PDB Entry: 5e9z (more details), 2.23 Å

PDB Description: cytochrome p450 bm3 mutant m11
PDB Compounds: (D:) Bifunctional cytochrome P450/NADPH--P450 reductase

SCOPe Domain Sequences for d5e9zd_:

Sequence, based on SEQRES records: (download)

>d5e9zd_ a.104.1.1 (D:) Cytochrome P450 bm-3 {Bacillus megaterium [TaxId: 1404]}
kempqpktfgelknlpllntdkpvqalmkiadelgeifkfeapglvtrylssqrlikeac
dgsrfdknlsqalkfvrdiagdglvtswtheknwkkahnillpsfsqqamkgyhammvdi
avqlvqkwerlnadehievpgdmtrltldtiglcgfnyrfnsfyrdqphpfitsmvrald
eamnkqqranpddpacdenkrqfqedikvmndlvdkiiadrkasgeqsddllthmlngkd
petgeplddeniryqiitfliaghvttsgllsfalyflvknpyvlqkaaeeaarvlvdpv
psykqvkqlkyvgmvlnealrlwptapafslyakedtvlggeyplekgdelmvlipqlhr
dktiwgddveefrperfenpsaipqhafkpfgngqracigqqfalheatlvlsmmlkhfd
fedhtnyeldiketltlkpegfvvkakskkiplg

Sequence, based on observed residues (ATOM records): (download)

>d5e9zd_ a.104.1.1 (D:) Cytochrome P450 bm-3 {Bacillus megaterium [TaxId: 1404]}
kempqpktfgelknlpllntdkpvqalmkiadelgeifkfeapglvtrylssqrlikeac
dgsrfdknlsqalkfvrdiagdglvtswtheknwkkahnillpsfsqqamkgyhammvdi
avqlvqkwerlnadehievpgdmtrltldtiglcgfnyrfnsfyrdqphpfitsmvrald
eamnkqqacdenkrqfqedikvmndlvdkiiadrkaqsddllthmlngkdpetgepldde
niryqiitfliaghvttsgllsfalyflvknpyvlqkaaeeaarvlvdpvpsykqvkqlk
yvgmvlnealrlwptapafslyakedtvlggeyplekgdelmvlipqlhrdktiwgddve
efrperfenpsaipqhafkpfgngqracigqqfalheatlvlsmmlkhfdfedhtnyeld
iketltlkpegfvvkakskkiplg

SCOPe Domain Coordinates for d5e9zd_:

Click to download the PDB-style file with coordinates for d5e9zd_.
(The format of our PDB-style files is described here.)

Timeline for d5e9zd_: