Lineage for d1a7ab2 (1a7a B:3-189,B:353-432)

  1. Root: SCOP 1.57
  2. 64291Class c: Alpha and beta proteins (a/b) [51349] (107 folds)
  3. 68133Fold c.23: Flavodoxin-like [52171] (17 superfamilies)
  4. 68583Superfamily c.23.12: Formate/glycerate dehydrogenase catalytic domain-like [52283] (3 families) (S)
  5. 68624Family c.23.12.3: S-adenosylhomocystein hydrolase [52300] (1 protein)
  6. 68625Protein S-adenosylhomocystein hydrolase [52301] (2 species)
  7. 68626Species Human (Homo sapiens) [TaxId:9606] [52302] (1 PDB entry)
  8. 68628Domain d1a7ab2: 1a7a B:3-189,B:353-432 [31365]
    Other proteins in same PDB: d1a7aa1, d1a7ab1

Details for d1a7ab2

PDB Entry: 1a7a (more details), 2.8 Å

PDB Description: structure of human placental s-adenosylhomocysteine hydrolase: determination of a 30 selenium atom substructure from data at a single wavelength

SCOP Domain Sequences for d1a7ab2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1a7ab2 c.23.12.3 (B:3-189,B:353-432) S-adenosylhomocystein hydrolase {Human (Homo sapiens)}
dklpykvadiglaawgrkaldiaenempglmrmrerysaskplkgariagclhmtvetav
lietlvtlgaevqwsscnifstqnhaaaaiakagipvyawkgetdeeylwcieqtlyfkd
gplnmilddggdltnlihtkypqllpgirgiseetttgvhnlykmmangilkvpainvnd
svtkskfXhpsfvmsnsftnqvmaqielwthpdkypvgvhflpkkldeavaeahlgklnv
kltkltekqaqylgmscdgpfkpdhyry

SCOP Domain Coordinates for d1a7ab2:

Click to download the PDB-style file with coordinates for d1a7ab2.
(The format of our PDB-style files is described here.)

Timeline for d1a7ab2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1a7ab1