Lineage for d5dyua1 (5dyu A:1858-1971)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2316812Fold a.29: Bromodomain-like [47363] (15 superfamilies)
    4 helices; bundle; minor mirror variant of up-and-down topology
  4. 2316813Superfamily a.29.2: Bromodomain [47370] (2 families) (S)
  5. 2316976Family a.29.2.0: automated matches [191428] (1 protein)
    not a true family
  6. 2316977Protein automated matches [190615] (11 species)
    not a true protein
  7. 2316984Species Human (Homo sapiens) [TaxId:9606] [187641] (716 PDB entries)
  8. 2317334Domain d5dyua1: 5dyu A:1858-1971 [313648]
    Other proteins in same PDB: d5dyua2
    automated match to d3uv2a_
    complexed with mz0

Details for d5dyua1

PDB Entry: 5dyu (more details), 1.65 Å

PDB Description: crystal structure of baz2b bromodomain in complex with fragment f39
PDB Compounds: (A:) Bromodomain adjacent to zinc finger domain protein 2B

SCOPe Domain Sequences for d5dyua1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5dyua1 a.29.2.0 (A:1858-1971) automated matches {Human (Homo sapiens) [TaxId: 9606]}
svkkpkrddskdlalcsmiltemethedawpfllpvnlklvpgykkvikkpmdfstirek
lssgqypnletfaldvrlvfdncetfneddsdigraghnmrkyfekkwtdtfkv

SCOPe Domain Coordinates for d5dyua1:

Click to download the PDB-style file with coordinates for d5dyua1.
(The format of our PDB-style files is described here.)

Timeline for d5dyua1:

View in 3D
Domains from same chain:
(mouse over for more information)
d5dyua2