Lineage for d1a7aa2 (1a7a A:2-189,A:353-432)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2855423Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2857659Superfamily c.23.12: Formate/glycerate dehydrogenase catalytic domain-like [52283] (3 families) (S)
  5. 2857771Family c.23.12.3: S-adenosylhomocystein hydrolase [52300] (1 protein)
  6. 2857772Protein S-adenosylhomocystein hydrolase [52301] (3 species)
    contains additional secondary structures disguising the superfamily fold
  7. 2857773Species Human (Homo sapiens) [TaxId:9606] [52302] (3 PDB entries)
  8. 2857775Domain d1a7aa2: 1a7a A:2-189,A:353-432 [31364]
    Other proteins in same PDB: d1a7aa1, d1a7ab1
    complexed with adc, nad

Details for d1a7aa2

PDB Entry: 1a7a (more details), 2.8 Å

PDB Description: structure of human placental s-adenosylhomocysteine hydrolase: determination of a 30 selenium atom substructure from data at a single wavelength
PDB Compounds: (A:) s-adenosylhomocysteine hydrolase

SCOPe Domain Sequences for d1a7aa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1a7aa2 c.23.12.3 (A:2-189,A:353-432) S-adenosylhomocystein hydrolase {Human (Homo sapiens) [TaxId: 9606]}
sdklpykvadiglaawgrkaldiaenempglmrmrerysaskplkgariagclhmtveta
vlietlvtlgaevqwsscnifstqnhaaaaiakagipvyawkgetdeeylwcieqtlyfk
dgplnmilddggdltnlihtkypqllpgirgiseetttgvhnlykmmangilkvpainvn
dsvtkskfXhpsfvmsnsftnqvmaqielwthpdkypvgvhflpkkldeavaeahlgkln
vkltkltekqaqylgmscdgpfkpdhyry

SCOPe Domain Coordinates for d1a7aa2:

Click to download the PDB-style file with coordinates for d1a7aa2.
(The format of our PDB-style files is described here.)

Timeline for d1a7aa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1a7aa1