Lineage for d5drpa2 (5drp A:128-268)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2930059Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily)
    core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossover
  4. 2930060Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (13 families) (S)
  5. 2930643Family d.14.1.7: UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine deacetylase LpxC [89827] (2 proteins)
    duplication; there are two structural repeats of this fold; each repeat is elaborated with additional structures forming the active site
  6. 2930644Protein UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine deacetylase LpxC [89828] (1 species)
  7. 2930645Species Aquifex aeolicus [TaxId:63363] [89829] (18 PDB entries)
    Uniprot O67648 3-270
  8. 2930671Domain d5drpa2: 5drp A:128-268 [313638]
    automated match to d1nzta4
    complexed with 5ep, cl, dms, zn

Details for d5drpa2

PDB Entry: 5drp (more details), 1.89 Å

PDB Description: structure of the aalpxc/lpc-023 complex
PDB Compounds: (A:) UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine deacetylase

SCOPe Domain Sequences for d5drpa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5drpa2 d.14.1.7 (A:128-268) UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine deacetylase LpxC {Aquifex aeolicus [TaxId: 63363]}
epiivedegrlikaepsdtlevtyegefknflgrqkftfvegneeeivlartfafdweie
hikkvglgkggslkntlvlgkdkvynpeglryenepvrhkvfdligdlyllgspvkgkfy
sfrgghslnvklvkelakkqk

SCOPe Domain Coordinates for d5drpa2:

Click to download the PDB-style file with coordinates for d5drpa2.
(The format of our PDB-style files is described here.)

Timeline for d5drpa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d5drpa1