Lineage for d5egca_ (5egc A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2821496Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies)
    sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands
    characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies
  4. 2823004Superfamily b.121.5: ssDNA viruses [88645] (4 families) (S)
  5. 2823027Family b.121.5.2: Parvoviridae-like VP [88646] (3 proteins)
    automatically mapped to Pfam PF00740
  6. 2823053Protein automated matches [190920] (12 species)
    not a true protein
  7. 2823054Species Adeno-associated virus - 1 [TaxId:85106] [255978] (3 PDB entries)
  8. 2823065Domain d5egca_: 5egc A: [313631]
    automated match to d3kica_
    protein/DNA complex; complexed with mg, sia

Details for d5egca_

PDB Entry: 5egc (more details), 3.01 Å

PDB Description: structure of the adeno-associated virus serotype 1 sialic acid complex
PDB Compounds: (A:) capsid protein

SCOPe Domain Sequences for d5egca_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5egca_ b.121.5.2 (A:) automated matches {Adeno-associated virus - 1 [TaxId: 85106]}
gadgvgnasgnwhcdstwlgdrvittstrtwalptynnhlykqissastgasndnhyfgy
stpwgyfdfnrfhchfsprdwqrlinnnwgfrpkrlnfklfniqvkevttndgvttiann
ltstvqvfsdseyqlpyvlgsahqgclppfpadvfmipqygyltlnngsqavgrssfycl
eyfpsqmlrtgnnftfsytfeevpfhssyahsqsldrlmnplidqylyylnrtqnqsgsa
qnkdllfsrgspagmsvqpknwlpgpcyrqqrvsktktdnnnsnftwtgaskynlngres
iinpgtamashkddedkffpmsgvmifgkesagasntaldnvmitdeeeikatnpvater
fgtvavnfqssstdpatgdvhamgalpgmvwqdrdvylqgpiwakiphtdghfhpsplmg
gfglknpppqilikntpvpanppaefsatkfasfitqystgqvsveiewelqkenskrwn
pevqytsnyaksanvdftvdnnglyteprpigtryltrpl

SCOPe Domain Coordinates for d5egca_:

Click to download the PDB-style file with coordinates for d5egca_.
(The format of our PDB-style files is described here.)

Timeline for d5egca_: