Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.23: Flavodoxin-like [52171] (15 superfamilies) 3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345 |
Superfamily c.23.5: Flavoproteins [52218] (9 families) |
Family c.23.5.3: Quinone reductase [52235] (4 proteins) binds FAD |
Protein NAD(P)H:quinone reductase [52236] (3 species) |
Species Human (Homo sapiens) [TaxId:9606] [52239] (13 PDB entries) |
Domain d5eaij_: 5eai J: [313623] automated match to d1d4aa_ complexed with e6a, fad |
PDB Entry: 5eai (more details), 2.9 Å
SCOPe Domain Sequences for d5eaij_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5eaij_ c.23.5.3 (J:) NAD(P)H:quinone reductase {Human (Homo sapiens) [TaxId: 9606]} grralivlahsertsfnyamkeaaaaalkkkgwevvesdlyamnfnpiisrkditgklkd panfqypaesvlaykeghlspdivaeqkkleaadlvifqfplqwfgvpailkgwfervfi gefaytyaamydkgpfrskkavlsittggsgsmyslqgihgdmnvilwpiqsgilhfcgf qvlepqltysightpadariqilegwkkrleniwdetplyfapsslfdlnfqagflmkke vqdeeknkkfglsvghhlgksiptdnqikar
Timeline for d5eaij_: