SCOPe 2.08: Domain d5dyol1: 5dyo L:1-112

Lineage for d5dyol1 (5dyo L:1-112)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [188198] (836 PDB entries)

8. Domain d5dyol1: 5dyo L:1-112 [313604]
   Other proteins in same PDB: d5dyoa_, d5dyob2, d5dyoh_, d5dyol2
   automated match to d2fd6l1
   complexed with flu, so4

Details for d5dyol1

PDB Entry: 5dyo, 2.36 Å

PDB Description: fab43.1 complex with flourescein

PDB Compounds: (L:) Fab 43.1 Light Chain

SCOPe Domain Sequences for d5dyol1:

Sequence; same for both SEQRES and ATOM records:

>d5dyol1 b.1.1.0 (L:1-112) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
dvvmtqtpltlsitigqpvsisckssqslfasdgrtylnwllqrpgqsperliylvsnld
sgvldrftgsgsgtdftlkisrveaedlgvyycwqgthfpqtfgggtkleik

Timeline for d5dyol1:

• d5dyol1 first appeared in SCOPe 2.06
  
• d5dyol1 appears in SCOPe 2.07