Lineage for d5dfsa_ (5dfs A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2690796Fold a.3: Cytochrome c [46625] (1 superfamily)
    core: 3 helices; folded leaf, opened
  4. 2690797Superfamily a.3.1: Cytochrome c [46626] (9 families) (S)
    covalently-bound heme completes the core
  5. 2690798Family a.3.1.1: monodomain cytochrome c [46627] (16 proteins)
  6. 2691036Protein Mitochondrial cytochrome c [46642] (7 species)
  7. 2691037Species Ateles sp. [TaxId:9511] [313555] (1 PDB entry)
  8. 2691038Domain d5dfsa_: 5dfs A: [313601]
    automated match to d3zooa_
    complexed with cl, edo, hec

Details for d5dfsa_

PDB Entry: 5dfs (more details), 1.15 Å

PDB Description: crystal structure of spider monkey cytochrome c at 1.15 angstrom
PDB Compounds: (A:) cytochrome c

SCOPe Domain Sequences for d5dfsa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5dfsa_ a.3.1.1 (A:) Mitochondrial cytochrome c {Ateles sp. [TaxId: 9511]}
gdvekgkrifimkcsqchtvekggkhktgpnlhglfgrktgqasgftyteanknkgiiwg
edtlmeylenpkkyipgtkmifvgikkkeeradliaylkkatne

SCOPe Domain Coordinates for d5dfsa_:

Click to download the PDB-style file with coordinates for d5dfsa_.
(The format of our PDB-style files is described here.)

Timeline for d5dfsa_: