![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.3: Cytochrome c [46625] (1 superfamily) core: 3 helices; folded leaf, opened |
![]() | Superfamily a.3.1: Cytochrome c [46626] (9 families) ![]() covalently-bound heme completes the core |
![]() | Family a.3.1.1: monodomain cytochrome c [46627] (16 proteins) |
![]() | Protein Mitochondrial cytochrome c [46642] (7 species) |
![]() | Species Ateles sp. [TaxId:9511] [313555] (1 PDB entry) |
![]() | Domain d5dfsa_: 5dfs A: [313601] automated match to d3zooa_ complexed with cl, edo, hec |
PDB Entry: 5dfs (more details), 1.15 Å
SCOPe Domain Sequences for d5dfsa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5dfsa_ a.3.1.1 (A:) Mitochondrial cytochrome c {Ateles sp. [TaxId: 9511]} gdvekgkrifimkcsqchtvekggkhktgpnlhglfgrktgqasgftyteanknkgiiwg edtlmeylenpkkyipgtkmifvgikkkeeradliaylkkatne
Timeline for d5dfsa_: