Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.23: Flavodoxin-like [52171] (15 superfamilies) 3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345 |
Superfamily c.23.1: CheY-like [52172] (8 families) |
Family c.23.1.1: CheY-related [52173] (26 proteins) |
Protein automated matches [190177] (9 species) not a true protein |
Species Escherichia coli [TaxId:83334] [313252] (3 PDB entries) |
Domain d5dgcb_: 5dgc B: [313600] automated match to d3ffwa_ complexed with bef, cl, gol, imd, mn |
PDB Entry: 5dgc (more details), 1.94 Å
SCOPe Domain Sequences for d5dgcb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5dgcb_ c.23.1.1 (B:) automated matches {Escherichia coli [TaxId: 83334]} adkelkflvvddqstmrrivrnllkelgfnnveeaedgvdalnklqaggygfvisdwkmp nmdglellktiradgamsalpvlmvtayakkeniiaaaqagasgyvvkpftaatleekln kifeklgm
Timeline for d5dgcb_: