SCOPe 2.06: Domain d2dldb2: 2dld B:1-103,B:301-337

Lineage for d2dldb2 (2dld B:1-103,B:301-337)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
   3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345

4. Superfamily c.23.12: Formate/glycerate dehydrogenase catalytic domain-like [52283] (3 families)

5. Family c.23.12.1: Formate/glycerate dehydrogenases, substrate-binding domain [52284] (7 proteins)
   this domain is interrupted by the Rossmann-fold domain

6. Protein D-lactate dehydrogenase [52295] (1 species)

7. Species Lactobacillus helveticus [TaxId:1587] [52296] (3 PDB entries)

8. Domain d2dldb2: 2dld B:1-103,B:301-337 [31360]
   Other proteins in same PDB: d2dlda1, d2dldb1
   complexed with nai, oxm

Details for d2dldb2

PDB Entry: 2dld, 2.7 Å

PDB Description: d-lactate dehydrogenase complexed with nadh and oxamate

PDB Compounds: (B:) d-lactate dehydrogenase

SCOPe Domain Sequences for d2dldb2:

Sequence; same for both SEQRES and ATOM records:

>d2dldb2 c.23.12.1 (B:1-103,B:301-337) D-lactate dehydrogenase {Lactobacillus helveticus [TaxId: 1587]}
mtkvfayairkdeepflnewkeahkdidvdytdklltpetaklakgadgvvvyqqldyta
dtlqaladagvtkmslrnvgvdnidmdkakelgfqitnvpvysXytthavrnmvvkafnn
nlklingekpdspvalnknkf

Timeline for d2dldb2:

• d2dldb2 first appeared (with stable ids) in SCOP 1.55
  
• d2dldb2 appears in SCOPe 2.05
  
• d2dldb2 appears in SCOPe 2.07
  
• d2dldb2 appears in the current release, SCOPe 2.08