Lineage for d2dldb2 (2dld B:1-103,B:301-337)

  1. Root: SCOP 1.63
  2. 235644Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 241017Fold c.23: Flavodoxin-like [52171] (16 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 241529Superfamily c.23.12: Formate/glycerate dehydrogenase catalytic domain-like [52283] (3 families) (S)
  5. 241530Family c.23.12.1: Formate/glycerate dehydrogenases, substrate-binding domain [52284] (7 proteins)
    this domain is interrupted by the Rossmann-fold domain
  6. 241538Protein D-lactate dehydrogenase [52295] (1 species)
  7. 241539Species Lactobacillus helveticus [TaxId:1587] [52296] (3 PDB entries)
  8. 241547Domain d2dldb2: 2dld B:1-103,B:301-337 [31360]
    Other proteins in same PDB: d2dlda1, d2dldb1
    complexed with nad, oxm

Details for d2dldb2

PDB Entry: 2dld (more details), 2.7 Å

PDB Description: d-lactate dehydrogenase complexed with nadh and oxamate

SCOP Domain Sequences for d2dldb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2dldb2 c.23.12.1 (B:1-103,B:301-337) D-lactate dehydrogenase {Lactobacillus helveticus}
mtkvfayairkdeepflnewkeahkdidvdytdklltpetaklakgadgvvvyqqldyta
dtlqaladagvtkmslrnvgvdnidmdkakelgfqitnvpvysXytthavrnmvvkafnn
nlklingekpdspvalnknkf

SCOP Domain Coordinates for d2dldb2:

Click to download the PDB-style file with coordinates for d2dldb2.
(The format of our PDB-style files is described here.)

Timeline for d2dldb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2dldb1