Lineage for d5e4ga_ (5e4g A:)

  1. Root: SCOPe 2.07
  2. 2634415Class g: Small proteins [56992] (98 folds)
  3. 2638316Fold g.17: Cystine-knot cytokines [57500] (1 superfamily)
    disulfide-rich fold; common core is all-beta
  4. 2638317Superfamily g.17.1: Cystine-knot cytokines [57501] (8 families) (S)
  5. 2638668Family g.17.1.0: automated matches [191392] (1 protein)
    not a true family
  6. 2638669Protein automated matches [190506] (3 species)
    not a true protein
  7. 2638670Species Human (Homo sapiens) [TaxId:9606] [187459] (38 PDB entries)
  8. 2638673Domain d5e4ga_: 5e4g A: [313595]
    automated match to d3hh2a_
    complexed with pg4

Details for d5e4ga_

PDB Entry: 5e4g (more details), 1.5 Å

PDB Description: crystal structure of human growth differentiation factor 11 (gdf-11)
PDB Compounds: (A:) Growth/differentiation factor 11

SCOPe Domain Sequences for d5e4ga_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5e4ga_ g.17.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lgldcdehssesrccrypltvdfeafgwdwiiapkrykanycsgqceymfmqkyphthlv
qqanprgsagpcctptkmspinmlyfndkqqiiygkipgmvvdrcgcs

SCOPe Domain Coordinates for d5e4ga_:

Click to download the PDB-style file with coordinates for d5e4ga_.
(The format of our PDB-style files is described here.)

Timeline for d5e4ga_: