SCOPe 2.08: Domain d5d96b2: 5d96 B:108-214

Lineage for d5d96b2 (5d96 B:108-214)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (15 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [224855] (650 PDB entries)

8. Domain d5d96b2: 5d96 B:108-214 [313594]
   Other proteins in same PDB: d5d96b1, d5d96c_, d5d96i1, d5d96j_
   automated match to d1tqbc2

Details for d5d96b2

PDB Entry: 5d96, 2.3 Å

PDB Description: oxidoreductase fragment of mouse qsox1 in complex with a fab fragment from an antibody targeting mouse and human qsox1

PDB Compounds: (B:) Light chain of Fab fragment from an antibody targeting mouse and human QSOX1

SCOPe Domain Sequences for d5d96b2:

Sequence; same for both SEQRES and ATOM records:

>d5d96b2 b.1.1.2 (B:108-214) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnrnec

Timeline for d5d96b2:

• d5d96b2 first appeared in SCOPe 2.06
  
• d5d96b2 appears in SCOPe 2.07