Lineage for d5dsto_ (5dst O:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2892669Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest
  4. 2892670Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (61 families) (S)
  5. 2892965Family c.66.1.6: Arginine methyltransferase [53351] (5 proteins)
    lacks the last two strands of the common fold replaced with a beta-sandwich oligomerisation subdomain
  6. 2892996Protein automated matches [254715] (3 species)
    not a true protein
  7. 2892997Species Human (Homo sapiens) [TaxId:9606] [313441] (18 PDB entries)
  8. 2893069Domain d5dsto_: 5dst O: [313592]
    automated match to d1orha_
    complexed with sah

Details for d5dsto_

PDB Entry: 5dst (more details), 2.96 Å

PDB Description: crystal structure of human prmt8 in complex with sah
PDB Compounds: (O:) Protein arginine N-methyltransferase 8

SCOPe Domain Sequences for d5dsto_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5dsto_ c.66.1.6 (O:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
syahfgiheemlkdevrtltyrnsmyhnkhvfkdkvvldvgsgtgilsmfaakagakkvf
giecssisdysekiikanhldniitifkgkveevelpvekvdiiisewmgyclfyesmln
tvifardkwlkpgglmfpdraalyvvaiedrqykdfkihwwenvygfdmtcirdvamkep
lvdivdpkqvvtnaclikevdiytvkteelsftsafclqiqrndyvhalvtyfnieftkc
hkkmgfstapdapythwkqtvfyledyltvrrgeeiygtismkpnaknvrdldftvdldf
kgqlcetsvsndykmr

SCOPe Domain Coordinates for d5dsto_:

Click to download the PDB-style file with coordinates for d5dsto_.
(The format of our PDB-style files is described here.)

Timeline for d5dsto_: