Lineage for d2dlda2 (2dld A:1-103,A:301-337)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 21773Fold c.23: Flavodoxin-like [52171] (16 superfamilies)
  4. 22195Superfamily c.23.12: Formate/glycerate dehydrogenase catalytic domain-like [52283] (3 families) (S)
  5. 22196Family c.23.12.1: Formate/glycerate dehydrogenases, substrate-binding domain [52284] (6 proteins)
  6. 22204Protein D-lactate dehydrogenase [52295] (1 species)
  7. 22205Species Lactobacillus helveticus [TaxId:1587] [52296] (1 PDB entry)
  8. 22206Domain d2dlda2: 2dld A:1-103,A:301-337 [31359]
    Other proteins in same PDB: d2dlda1, d2dldb1

Details for d2dlda2

PDB Entry: 2dld (more details), 2.7 Å

PDB Description: d-lactate dehydrogenase complexed with nadh and oxamate

SCOP Domain Sequences for d2dlda2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2dlda2 c.23.12.1 (A:1-103,A:301-337) D-lactate dehydrogenase {Lactobacillus helveticus}
mtkvfayairkdeepflnewkeahkdidvdytdklltpetaklakgadgvvvyqqldyta
dtlqaladagvtkmslrnvgvdnidmdkakelgfqitnvpvysXytthavrnmvvkafnn
nlklingekpdspvalnknkf

SCOP Domain Coordinates for d2dlda2:

Click to download the PDB-style file with coordinates for d2dlda2.
(The format of our PDB-style files is described here.)

Timeline for d2dlda2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2dlda1