SCOPe 2.06: Domain d1psdb2: 1psd B:7-107,B:296-326

Lineage for d1psdb2 (1psd B:7-107,B:296-326)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
   3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345

4. Superfamily c.23.12: Formate/glycerate dehydrogenase catalytic domain-like [52283] (3 families)

5. Family c.23.12.1: Formate/glycerate dehydrogenases, substrate-binding domain [52284] (7 proteins)
   this domain is interrupted by the Rossmann-fold domain

6. Protein Phosphoglycerate dehydrogenase [52293] (2 species)
   has additional C-terminal domain of the ferredoxin fold

7. Species Escherichia coli [TaxId:562] [52294] (7 PDB entries)

8. Domain d1psdb2: 1psd B:7-107,B:296-326 [31358]
   Other proteins in same PDB: d1psda1, d1psda3, d1psdb1, d1psdb3
   complexed with nad, ser

Details for d1psdb2

PDB Entry: 1psd, 2.75 Å

PDB Description: the allosteric ligand site in the vmax-type cooperative enzyme phosphoglycerate dehydrogenase

PDB Compounds: (B:) d-3-phosphoglycerate dehydrogenase (phosphoglycerate dehydrogenase)

SCOPe Domain Sequences for d1psdb2:

Sequence; same for both SEQRES and ATOM records:

>d1psdb2 c.23.12.1 (B:7-107,B:296-326) Phosphoglycerate dehydrogenase {Escherichia coli [TaxId: 562]}
ekdkikfllvegvhqkaleslraagytniefhkgalddeqlkesirdahfiglrsrthlt
edvinaaeklvaigcfcigtnqvdldaaakrgipvfnapfsXstqeaqeniglevagkli
kysdngstlsavn

Timeline for d1psdb2:

• d1psdb2 first appeared (with stable ids) in SCOP 1.55
  
• d1psdb2 appears in SCOPe 2.05
  
• d1psdb2 appears in SCOPe 2.07
  
• d1psdb2 appears in the current release, SCOPe 2.08