Lineage for d1psdb2 (1psd B:7-107,B:296-326)

  1. Root: SCOP 1.61
  2. 172677Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 177542Fold c.23: Flavodoxin-like [52171] (16 superfamilies)
  4. 178031Superfamily c.23.12: Formate/glycerate dehydrogenase catalytic domain-like [52283] (3 families) (S)
  5. 178032Family c.23.12.1: Formate/glycerate dehydrogenases, substrate-binding domain [52284] (6 proteins)
  6. 178056Protein Phosphoglycerate dehydrogenase [52293] (1 species)
  7. 178057Species Escherichia coli [TaxId:562] [52294] (1 PDB entry)
  8. 178059Domain d1psdb2: 1psd B:7-107,B:296-326 [31358]
    Other proteins in same PDB: d1psda1, d1psda3, d1psdb1, d1psdb3

Details for d1psdb2

PDB Entry: 1psd (more details), 2.75 Å

PDB Description: the allosteric ligand site in the vmax-type cooperative enzyme phosphoglycerate dehydrogenase
PDB Compounds: (B:)

SCOP Domain Sequences for d1psdb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1psdb2 c.23.12.1 (B:7-107,B:296-326) Phosphoglycerate dehydrogenase {Escherichia coli}
ekdkikfllvegvhqkaleslraagytniefhkgalddeqlkesirdahfiglrsrthlt
edvinaaeklvaigcfcigtnqvdldaaakrgipvfnapfsXstqeaqeniglevagkli
kysdngstlsavn

SCOP Domain Coordinates for d1psdb2:

Click to download the PDB-style file with coordinates for d1psdb2.
(The format of our PDB-style files is described here.)

Timeline for d1psdb2: