SCOPe 2.06: Domain d5d7jh2: 5d7j H:116-244

Lineage for d5d7jh2 (5d7j H:116-244)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (28 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (935 PDB entries)

8. Domain d5d7jh2: 5d7j H:116-244 [313570]
   Other proteins in same PDB: d5d7ja2, d5d7jc1, d5d7jd_, d5d7je1, d5d7jf1, d5d7jf2, d5d7jg2
   automated match to d3q5ya2
   complexed with 2lj, gol

Details for d5d7jh2

PDB Entry: 5d7j, 1.97 Å

PDB Description: structure of human mr1-5-op-ru in complex with human mait m33.64(y95alphaf) tcr

PDB Compounds: (H:) M33.64 TCR Beta Chain

SCOPe Domain Sequences for d5d7jh2:

Sequence; same for both SEQRES and ATOM records:

>d5d7jh2 b.1.1.0 (H:116-244) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dlknvfppevavfepseaeishtqkatlvclatgfypdhvelswwvngkevhsgvctdpq
plkeqpalndsryalssrlrvsatfwqnprnhfrcqvqfyglsendewtqdrakpvtqiv
saeawgrad

Timeline for d5d7jh2:

• d5d7jh2 is new in SCOPe 2.06-stable
  
• d5d7jh2 appears in SCOPe 2.07
  
• d5d7jh2 appears in the current release, SCOPe 2.08